Reaction SMILES-AA mapping via language modelling

Related tags

Deep Learningrxnaamapper
Overview

rxn-aa-mapper

Reactions SMILES-AA sequence mapping

setup

conda env create -f conda.yml
conda activate rxn_aa_mapper

In the following we consider on examples provided to show how to use RXNAAMapper.

generate a vocabulary to be used with the EnzymaticReactionBertTokenizer

Create a vocabulary compatible with the enzymatic reaction tokenizer:

create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"

use the tokenizer

Using the examples vocabulary and AA tokenizer provided, we can observe the enzymatic reaction tokenizer in action:

from rxn_aa_mapper.tokenization import EnzymaticReactionBertTokenizer

tokenizer = EnzymaticReactionBertTokenizer(
    vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")

train the model

The mlm-trainer script can be used to train a model via MTL:

mlm-trainer \
    ./examples/data-samples/biochemical ./examples/data-samples/biochemical \  # just a sample, simply split data in a train and a validation folder
    ./examples/vocabulary_token_75K_min_600_max_750_500K.txt /tmp/mlm-trainer-log \
    ./examples/sample-config.json "*.csv" 1 \  # for a more realistic config see ./examples/config.json
    ./examples/data-samples/organic ./examples/data-samples/organic \  # just a sample, simply split data in a train and a validation folder
    ./examples/token_75K_min_600_max_750_500K.json

Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.

Those can be turned into an HuggingFace model by simply running:

checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json

predict active site

The trained model can used to map reactant atoms to AA sequence locations that potentially represent the active site.

from rxn_aa_mapper.aa_mapper import RXNAAMapper

config_mapper = {
    "vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    "aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
    "model_path": "/tmp/rxnaamapper-pretrained-model",
    "head": 3,
    "layers": [11],
    "top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])

citation

@article{dassi2021identification,
  title={Identification of Enzymatic Active Sites with Unsupervised Language Modeling},
  author={Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Teukam, Yves Gaetan Nana and Laino, Teodoro},
  year={2021}
  conference={AI for Science: Mind the Gaps at NeurIPS 2021, ELLIS Machine Learning for Molecule Discovery Workshop 2021}
}
Owner
GitHub Repository
Deep functional residue identification

DeepFRI Deep functional residue identification Citing @article {Gligorijevic2019, author = {Gligorijevic, Vladimir and Renfrew, P. Douglas and Koscio

Flatiron Institute 156 Dec 25, 2022
[CVPR 2022 Oral] TubeDETR: Spatio-Temporal Video Grounding with Transformers

TubeDETR: Spatio-Temporal Video Grounding with Transformers Website • STVG Demo • Paper This repository provides the code for our paper. This includes

Antoine Yang 108 Dec 27, 2022
PocketNet: Extreme Lightweight Face Recognition Network using Neural Architecture Search and Multi-Step Knowledge Distillation

PocketNet This is the official repository of the paper: PocketNet: Extreme Lightweight Face Recognition Network using Neural Architecture Search and M

Fadi Boutros 40 Dec 22, 2022
U2-Net: Going Deeper with Nested U-Structure for Salient Object Detection

The code for our newly accepted paper in Pattern Recognition 2020: "U^2-Net: Going Deeper with Nested U-Structure for Salient Object Detection."

Xuebin Qin 6.5k Jan 09, 2023
Code repository accompanying the paper "On Adversarial Robustness: A Neural Architecture Search perspective"

On Adversarial Robustness: A Neural Architecture Search perspective Preparation: Clone the repository: https://github.com/tdchaitanya/nas-robustness.g

Chaitanya Devaguptapu 4 Nov 10, 2022
Meta Representation Transformation for Low-resource Cross-lingual Learning

MetaXL: Meta Representation Transformation for Low-resource Cross-lingual Learning This repo hosts the code for MetaXL, published at NAACL 2021. [Meta

Microsoft 36 Aug 17, 2022
Pytorch Lightning Distributed Accelerators using Ray

Distributed PyTorch Lightning Training on Ray This library adds new PyTorch Lightning plugins for distributed training using the Ray distributed compu

167 Jan 02, 2023
sense-py-AnishaBaishya created by GitHub Classroom

Compute Statistics Here we compute statistics for a bunch of numbers. This project uses the unittest framework to test functionality. Pass the tests T

1 Oct 21, 2021
Winning solution of the Indoor Location & Navigation Kaggle competition

This repository contains the code to generate the winning solution of the Kaggle competition on indoor location and navigation organized by Microsoft

Tom Van de Wiele 62 Dec 28, 2022
The FIRST GANs-based omics-to-omics translation framework

OmiTrans Please also have a look at our multi-omics multi-task DL freamwork 👀 : OmiEmbed The FIRST GANs-based omics-to-omics translation framework Xi

Xiaoyu Zhang 6 Dec 14, 2022
Weakly Supervised Segmentation by Tensorflow.

Weakly Supervised Segmentation by Tensorflow. Implements semantic segmentation in Simple Does It: Weakly Supervised Instance and Semantic Segmentation, by Khoreva et al. (CVPR 2017).

CHENG-YOU LU 52 Dec 27, 2022
This repository comes with the paper "On the Robustness of Counterfactual Explanations to Adverse Perturbations"

Robust Counterfactual Explanations This repository comes with the paper "On the Robustness of Counterfactual Explanations to Adverse Perturbations". I

Marco 5 Dec 20, 2022
Boundary IoU API (Beta version)

Boundary IoU API (Beta version) Bowen Cheng, Ross Girshick, Piotr Dollár, Alexander C. Berg, Alexander Kirillov [arXiv] [Project] [BibTeX] This API is

Bowen Cheng 177 Dec 29, 2022
PyTorch implementation of ENet

PyTorch-ENet PyTorch (v1.1.0) implementation of ENet: A Deep Neural Network Architecture for Real-Time Semantic Segmentation, ported from the lua-torc

David Silva 333 Dec 29, 2022
This repository is maintained for the scientific paper tittled " Study of keyword extraction techniques for Electric Double Layer Capacitor domain using text similarity indexes: An experimental analysis "

kwd-extraction-study This repository is maintained for the scientific paper tittled " Study of keyword extraction techniques for Electric Double Layer

ping 543f 1 Dec 05, 2022
Gapmm2: gapped alignment using minimap2 (align transcripts to genome)

gapmm2: gapped alignment using minimap2 This tool is a wrapper for minimap2 to r

Jon Palmer 2 Jan 27, 2022
An implementation for the loss function proposed in Decoupled Contrastive Loss paper.

Decoupled-Contrastive-Learning This repository is an implementation for the loss function proposed in Decoupled Contrastive Loss paper. Requirements P

Ramin Nakhli 71 Dec 04, 2022
Fast, flexible and easy to use probabilistic modelling in Python.

Please consider citing the JMLR-MLOSS Manuscript if you've used pomegranate in your academic work! pomegranate is a package for building probabilistic

Jacob Schreiber 3k Dec 29, 2022
House_prices_kaggle - Predict sales prices and practice feature engineering, RFs, and gradient boosting

House Prices - Advanced Regression Techniques Predicting House Prices with Machine Learning This project is build to enhance my knowledge about machin

Gurpreet Singh 1 Jan 01, 2022
Asymmetric metric learning for knowledge transfer

Asymmetric metric learning This is the official code that enables the reproduction of the results from our paper: Asymmetric metric learning for knowl

20 Dec 06, 2022