Reaction SMILES-AA mapping via language modelling

Related tags

Deep Learningrxnaamapper
Overview

rxn-aa-mapper

Reactions SMILES-AA sequence mapping

setup

conda env create -f conda.yml
conda activate rxn_aa_mapper

In the following we consider on examples provided to show how to use RXNAAMapper.

generate a vocabulary to be used with the EnzymaticReactionBertTokenizer

Create a vocabulary compatible with the enzymatic reaction tokenizer:

create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"

use the tokenizer

Using the examples vocabulary and AA tokenizer provided, we can observe the enzymatic reaction tokenizer in action:

from rxn_aa_mapper.tokenization import EnzymaticReactionBertTokenizer

tokenizer = EnzymaticReactionBertTokenizer(
    vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")

train the model

The mlm-trainer script can be used to train a model via MTL:

mlm-trainer \
    ./examples/data-samples/biochemical ./examples/data-samples/biochemical \  # just a sample, simply split data in a train and a validation folder
    ./examples/vocabulary_token_75K_min_600_max_750_500K.txt /tmp/mlm-trainer-log \
    ./examples/sample-config.json "*.csv" 1 \  # for a more realistic config see ./examples/config.json
    ./examples/data-samples/organic ./examples/data-samples/organic \  # just a sample, simply split data in a train and a validation folder
    ./examples/token_75K_min_600_max_750_500K.json

Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.

Those can be turned into an HuggingFace model by simply running:

checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json

predict active site

The trained model can used to map reactant atoms to AA sequence locations that potentially represent the active site.

from rxn_aa_mapper.aa_mapper import RXNAAMapper

config_mapper = {
    "vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    "aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
    "model_path": "/tmp/rxnaamapper-pretrained-model",
    "head": 3,
    "layers": [11],
    "top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])

citation

@article{dassi2021identification,
  title={Identification of Enzymatic Active Sites with Unsupervised Language Modeling},
  author={Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Teukam, Yves Gaetan Nana and Laino, Teodoro},
  year={2021}
  conference={AI for Science: Mind the Gaps at NeurIPS 2021, ELLIS Machine Learning for Molecule Discovery Workshop 2021}
}
Owner
GitHub Repository
Neuralnetwork - Basic Multilayer Perceptron Neural Network for deep learning

Neural Network Just a basic Neural Network module Usage Example Importing Module

andreecy 0 Nov 01, 2022
Much faster than SORT(Simple Online and Realtime Tracking), a little worse than SORT

QSORT QSORT(Quick + Simple Online and Realtime Tracking) is a simple online and realtime tracking algorithm for 2D multiple object tracking in video s

Yonghye Kwon 8 Jul 27, 2022
A graph neural network (GNN) model to predict protein-protein interactions (PPI) with no sample features

A graph neural network (GNN) model to predict protein-protein interactions (PPI) with no sample features

2 Jul 25, 2022
A little Python application to auto tag your photos with the power of machine learning.

Tag Machine A little Python application to auto tag your photos with the power of machine learning. Report a bug or request a feature Table of Content

Florian Torres 14 Dec 21, 2022
Whisper is a file-based time-series database format for Graphite.

Whisper Overview Whisper is one of three components within the Graphite project: Graphite-Web, a Django-based web application that renders graphs and

Graphite Project 1.2k Dec 25, 2022
CONditionals for Ordinal Regression and classification in tensorflow

Condor Ordinal regression in Tensorflow Keras Tensorflow Keras implementation of CONDOR Ordinal Regression (aka ordinal classification) by Garrett Jen

9 Jul 31, 2022
A whale detector design for the Kaggle whale-detector challenge!

CNN (InceptionV1) + STFT based Whale Detection Algorithm So, this repository is my PyTorch solution for the Kaggle whale-detection challenge. The obje

Tarin Ziyaee 92 Sep 28, 2021
A solution to the 2D Ising model of ferromagnetism, implemented using the Metropolis algorithm

Solving the Ising model on a 2D lattice using the Metropolis Algorithm Introduction The Ising model is a simplified model of ferromagnetism, the pheno

Rohit Prabhu 5 Nov 13, 2022
Code for testing various M1 Chip benchmarks with TensorFlow.

M1, M1 Pro, M1 Max Machine Learning Speed Test Comparison This repo contains some sample code to benchmark the new M1 MacBooks (M1 Pro and M1 Max) aga

Daniel Bourke 348 Jan 04, 2023
This repository contains FEDOT - an open-source framework for automated modeling and machine learning (AutoML)

package tests docs license stats support This repository contains FEDOT - an open-source framework for automated modeling and machine learning (AutoML

National Center for Cognitive Research of ITMO University 482 Dec 26, 2022
PyTorch implementation of Octave Convolution with pre-trained Oct-ResNet and Oct-MobileNet models

octconv.pytorch PyTorch implementation of Octave Convolution in Drop an Octave: Reducing Spatial Redundancy in Convolutional Neural Networks with Octa

Duo Li 273 Dec 18, 2022
Reinfore learning tool box, contains trpo, a3c algorithm for continous action space

RL_toolbox all the algorithm is running on pycharm IDE, or the package loss error may exist. implemented algorithm: trpo a3c a3c:for continous action

yupei.wu 44 Oct 10, 2022
A web porting for NVlabs' StyleGAN2, to facilitate exploring all kinds characteristic of StyleGAN networks

This project is a web porting for NVlabs' StyleGAN2, to facilitate exploring all kinds characteristic of StyleGAN networks. Thanks for NVlabs' excelle

K.L. 150 Dec 15, 2022
ICRA 2021 "Towards Precise and Efficient Image Guided Depth Completion"

PENet: Precise and Efficient Depth Completion This repo is the PyTorch implementation of our paper to appear in ICRA2021 on "Towards Precise and Effic

232 Dec 25, 2022
A no-BS, dead-simple training visualizer for tf-keras

A no-BS, dead-simple training visualizer for tf-keras TrainingDashboard Plot inter-epoch and intra-epoch loss and metrics within a jupyter notebook wi

Vibhu Agrawal 3 May 28, 2021
Stacked Hourglass Network with a Multi-level Attention Mechanism: Where to Look for Intervertebral Disc Labeling

⚠️ ‎‎‎ A more recent and actively-maintained version of this code is available in ivadomed Stacked Hourglass Network with a Multi-level Attention Mech

Reza Azad 14 Oct 24, 2022
A Dataset of Python Challenges for AI Research

Python Programming Puzzles (P3) This repo contains a dataset of python programming puzzles which can be used to teach and evaluate an AI's programming

Microsoft 850 Dec 24, 2022
Air Quality Prediction Using LSTM

AirQualityPredictionUsingLSTM In this Repo, i present to you the winning solution of smart gujarat hackathon 2019 where the task was to predict the qu

Deepak Nandwani 2 Dec 13, 2022
Single-Stage 6D Object Pose Estimation, CVPR 2020

Overview This repository contains the code for the paper Single-Stage 6D Object Pose Estimation. Yinlin Hu, Pascal Fua, Wei Wang and Mathieu Salzmann.

CVLAB @ EPFL 89 Dec 26, 2022
Shallow Convolutional Neural Networks for Human Activity Recognition using Wearable Sensors

-IEEE-TIM-2021-1-Shallow-CNN-for-HAR [IEEE TIM 2021-1] Shallow Convolutional Neural Networks for Human Activity Recognition using Wearable Sensors All

Wenbo Huang 1 May 17, 2022