peptides.py is a pure-Python package to compute common descriptors for protein sequences

Related tags

Data Analysispeptides.py
Overview

peptides.py Stars

Physicochemical properties and indices for amino-acid sequences.

Actions Coverage PyPI Wheel Python Versions Python Implementations License Source Mirror GitHub issues Changelog Downloads

🗺️ Overview

peptides.py is a pure-Python package to compute common descriptors for protein sequences. It is a port of Peptides, the R package written by Daniel Osorio for the same purpose. This library has no external dependency and is available for all modern Python versions (3.6+).

🔧 Installing

Install the peptides package directly from PyPi which hosts universal wheels that can be installed with pip:

$ pip install peptides

💡 Example

Start by creating a Peptide object from a protein sequence:

>>> import peptides
>>> peptide = peptides.Peptide("MLKKRFLGALAVATLLTLSFGTPVMAQSGSAVFTNEGVTPFAISYPGGGT")

Then use the appropriate methods to compute the descriptors you want:

>>> peptide.aliphatic_index()
89.8...
>>> peptide.boman()
-0.2097...
>>> peptide.charge(pH=7.4)
1.99199...
>>> peptide.isoelectric_point()
10.2436...

Methods that return more than one scalar value (for instance, Peptide.blosum_indices) will return a dedicated named tuple:

>>> peptide.ms_whim_scores()
MSWHIMScores(mswhim1=-0.436399..., mswhim2=0.4916..., mswhim3=-0.49200...)

Use the Peptide.descriptors method to get a dictionary with every available descriptor. This makes it very easy to create a pandas.DataFrame with descriptors for several protein sequences:

>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ]) >>> df BLOSUM1 BLOSUM2 BLOSUM3 BLOSUM4 ... Z2 Z3 Z4 Z5 0 0.367000 -0.436000 -0.239 0.014500 ... -0.711000 -0.104500 -1.486500 0.429500 1 -0.697500 -0.372500 -0.493 0.157000 ... -0.307500 -0.627500 -0.450500 0.362000 2 0.479333 -0.001333 0.138 0.228667 ... -0.299333 0.465333 -0.976667 0.023333 [3 rows x 66 columns] "> 
>>> seqs = ["SDKEVDEVDAALSDLEITLE", "ARQQNLFINFCLILIFLLLI", "EGVNDNECEGFFSAR"]
>>> df = pandas.DataFrame([ peptides.Peptide(s).descriptors() for s in seqs ])
>>> df
    BLOSUM1   BLOSUM2  BLOSUM3   BLOSUM4  ...        Z2        Z3        Z4        Z5
0  0.367000 -0.436000   -0.239  0.014500  ... -0.711000 -0.104500 -1.486500  0.429500
1 -0.697500 -0.372500   -0.493  0.157000  ... -0.307500 -0.627500 -0.450500  0.362000
2  0.479333 -0.001333    0.138  0.228667  ... -0.299333  0.465333 -0.976667  0.023333

[3 rows x 66 columns]

💭 Feedback

⚠️ Issue Tracker

Found a bug ? Have an enhancement request ? Head over to the GitHub issue tracker if you need to report or ask something. If you are filing in on a bug, please include as much information as you can about the issue, and try to recreate the same bug in a simple, easily reproducible situation.

🏗️ Contributing

Contributions are more than welcome! See CONTRIBUTING.md for more details.

⚖️ License

This library is provided under the GNU General Public License v3.0. The original R Peptides package was written by Daniel Osorio, Paola Rondón-Villarreal and Rodrigo Torres, and is licensed under the terms of the GPLv2.

This project is in no way not affiliated, sponsored, or otherwise endorsed by the original Peptides authors. It was developed by Martin Larralde during his PhD project at the European Molecular Biology Laboratory in the Zeller team.

You might also like...
Python Package for DataHerb: create, search, and load datasets.
Python Package for DataHerb: create, search, and load datasets.

The Python Package for DataHerb A DataHerb Core Service to Create and Load Datasets.

DataHerb 4 Feb 11, 2022
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information
wikirepo is a Python package that provides a framework to easily source and leverage standardized Wikidata information

Python based Wikidata framework for easy dataframe extraction wikirepo is a Python package that provides a framework to easily source and leverage sta

Andrew Tavis McAllister 35 Jan 4, 2023
Python package for processing UC module spectral data.

UC Module Python Package How To Install clone repo. cd UC-module pip install . How to Use uc.module.UC(measurment=str, dark=str, reference=str, heade

Nicolai Haaber Junge 1 Oct 20, 2021
sportsdataverse python package
sportsdataverse python package

sportsdataverse-py See CHANGELOG.md for details. The goal of sportsdataverse-py is to provide the community with a python package for working with spo

Saiem Gilani 37 Dec 27, 2022
PyEmits, a python package for easy manipulation in time-series data.
PyEmits, a python package for easy manipulation in time-series data.

PyEmits, a python package for easy manipulation in time-series data. Time-series data is very common in real life. Engineering FSI industry (Financial

Thompson 5 Sep 23, 2022
Retail-Sim is python package to easily create synthetic dataset of retaile store.

Retailer's Sale Data Simulation Retail-Sim is python package to easily create synthetic dataset of retaile store. Simulation Model Simulator consists

Corca AI 7 Sep 30, 2022
A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

Rishikesh S 4 Oct 17, 2022
VevestaX is an open source Python package for ML Engineers and Data Scientists.
VevestaX is an open source Python package for ML Engineers and Data Scientists.

VevestaX Track failed and successful experiments as well as features. VevestaX is an open source Python package for ML Engineers and Data Scientists.

Vevesta 24 Dec 14, 2022
nrgpy is the Python package for processing NRG Data Files

nrgpy nrgpy is the Python package for processing NRG Data Files Website and source: https://github.com/nrgpy/nrgpy Documentation: https://nrgpy.github

NRG Tech Services 23 Dec 8, 2022
Comments
  • Per-residue data

    Per-residue data

    It seems that the API can only output single statistics for the entire peptide chain, but I'm interested in statistics for each residue individually. I'm wondering if it might be possible to output an array/list from some of these functions instead of always averaging them as is done now.

    enhancement 
    opened by multimeric 1
  • Hydrophobic moment is inconsistent with R version

    Hydrophobic moment is inconsistent with R version

    Computed hydrophobic moment is not the same as the one computed by R. More specifically, it seems that peptides.py always outputs 0 for the hydrophobic moment when peptide length is shorter than the set window. The returned value matches the value from R when peptide length is equal to or greater than the set window length.

    Example in python:

    >>> import peptides`
>>> peptides.Peptide("MLK").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("AACQ").hydrophobic_moment(window=5, angle=100)
0.0
>>> peptides.Peptide("FGGIQ").hydrophobic_moment(window=5, angle=100)
0.31847187610377536

    Example in R:

    > library(Peptides)
> hmoment(seq="MLK", window=5, angle=100)
[1] 0.8099386
> hmoment(seq="AACQ", window=5, angle=100)
[1] 0.3152961
> hmoment(seq="FGGIQ", window=5, angle=100)
[1] 0.3184719

    I think that it can be easily fixed by internally setting the window length to the length of the peptide if the latter is shorter. What I propose:

    --- a/peptides/__init__.py
+++ b/peptides/__init__.py
@@ -657,6 +657,7 @@ class Peptide(typing.Sequence[str]):
               :doi:`10.1073/pnas.81.1.140`. :pmid:`6582470`.

         """
+        window = min(window, len(self))
         scale = tables.HYDROPHOBICITY["Eisenberg"]
         lut = [scale.get(aa, 0.0) for aa in self._CODE1]
         angles = [(angle * i) % 360 for i in range(window)]
    bug 
    opened by eotovic 1
  • RuntimeWarning in auto_correlation function()

    RuntimeWarning in auto_correlation function()

    Hi, thank you for creating peptides.py.

    Some hydrophobicity tables together with certain proteins cause a runtime warning for in the function auto_correlation():

    import peptides

for hydro in peptides.tables.HYDROPHOBICITY.keys():
    print(hydro)
    table = peptides.tables.HYDROPHOBICITY[hydro]
    peptides.Peptide('MANTQNISIWWWAR').auto_correlation(table)

    Warning (s2 == 0):

    RuntimeWarning: invalid value encountered in double_scalars
  return s1 / s2

    The tables concerned are: octanolScale_pH2, interfaceScale_pH2, oiScale_pH2 Some other proteins causing the same warning: ['MSYGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGYGY', 'MFILLIIIGASCFGGGGGCGYGGYGGYAGGYGGYCC', 'MSFGGSCAGFGGGFALLIVLFILLIIIGCSCWGGGGGF']

    opened by jhahnfeld 0
Releases(v0.3.1)

  • v0.3.1(Sep 1, 2022)

  • v0.3.0(Sep 1, 2022)

    Added

    • Peptide.linker_preference_profile to build a profile like used in the DomCut method from Suyama & Ohara (2002).
    • Peptide.profile to build a generic per-residue profile from a data table (#3).
    Source code(tar.gz)
    Source code(zip)

  • v0.2.0(Oct 25, 2021)

    Added

    • Peptide.counts method to get the number of occurences of each amino acid in the peptide.
    • Peptide.frequencies to get the frequencies of each amino acid in the peptide.
    • Peptide.pcp_descriptors to compute the PCP descriptors from Mathura & Braun (2001).
    • Peptide.sneath_vectors to compute the descriptors from Sneath (1966).
    • Hydrophilicity descriptors from Barley (2018).
    • Peptide.structural_class to predict the structural class of a protein using one of three reference datasets and one of four distance metrics.

    Changed

    • Peptide.aliphatic_index now supports unknown Leu/Ile residue (code J).
    • Swap order of Peptide.hydrophobic_moment arguments for consistency with profile methods.
    • Some Peptide functions now support vectorized code using numpy if available.
    Source code(tar.gz)
    Source code(zip)

  • v0.1.0(Oct 21, 2021)

Owner
Martin Larralde
PhD candidate in Bioinformatics, passionate about programming, Pythonista, Rustacean. I write poems, and sometimes they are executable.
Martin Larralde
GitHub Repository
Data and code accompanying the paper Politics and Virality in the Time of Twitter

Politics and Virality in the Time of Twitter Data and code accompanying the paper Politics and Virality in the Time of Twitter. In specific: the code

Cardiff NLP 3 Jul 02, 2022
AptaMat is a simple script which aims to measure differences between DNA or RNA secondary structures.

AptaMAT Purpose AptaMat is a simple script which aims to measure differences between DNA or RNA secondary structures. The method is based on the compa

GEC UTC 3 Nov 03, 2022
Repository created with LinkedIn profile analysis project done

EN/en Repository created with LinkedIn profile analysis project done. The datase

Mayara Canaver 4 Aug 06, 2022
Analyze the Gravitational wave data stored at LIGO/VIRGO observatories

Gravitational-Wave-Analysis This project showcases how to analyze the Gravitational wave data stored at LIGO/VIRGO observatories, using Python program

1 Jan 23, 2022
Common bioinformatics database construction

biodb Common bioinformatics database construction 1.taxonomy （Substance classification database） Download the database wget -c https://ftp.ncbi.nlm.ni

sy520 2 Jan 04, 2022
Analysiscsv.py for extracting analysis and exporting as CSV

wcc_analysis Lichess page documentation: https://lichess.org/page/world-championships Each WCC has a study, studies are fetched using: https://lichess

32 Apr 25, 2022
Exploratory Data Analysis for Employee Retention Dataset

Exploratory Data Analysis for Employee Retention Dataset Employee turn-over is a very costly problem for companies. The cost of replacing an employee

kana sudheer reddy 2 Oct 01, 2021
Hydrogen (or other pure gas phase species) depressurization calculations

HydDown Hydrogen (or other pure gas phase species) depressurization calculations This code is published under an MIT license. Install as simple as: pi

Anders Andreasen 13 Nov 26, 2022
A python package which can be pip installed to perform statistics and visualize binomial and gaussian distributions of the dataset

GBiStat package A python package to assist programmers with data analysis. This package could be used to plot : Binomial Distribution of the dataset p

Rishikesh S 4 Oct 17, 2022
WaveFake: A Data Set to Facilitate Audio DeepFake Detection

WaveFake: A Data Set to Facilitate Audio DeepFake Detection This is the code repository for our NeurIPS 2021 (Track on Datasets and Benchmarks) paper

Chair for Sys­tems Se­cu­ri­ty 27 Dec 22, 2022
Statistical package in Python based on Pandas

Pingouin is an open-source statistical package written in Python 3 and based mostly on Pandas and NumPy. Some of its main features are listed below. F

Raphael Vallat 1.2k Dec 31, 2022
Aggregating gridded data (xarray) to polygons

A package to aggregate gridded data in xarray to polygons in geopandas using area-weighting from the relative area overlaps between pixels and polygons. Check out the binder link above for a sample c

Kevin Schwarzwald 42 Nov 09, 2022
MEAD: A Large-scale Audio-visual Dataset for Emotional Talking-face Generation [ECCV2020]

MEAD: A Large-scale Audio-visual Dataset for Emotional Talking-face Generation [ECCV2020] by Kaisiyuan Wang, Qianyi Wu, Linsen Song, Zhuoqian Yang, Wa

112 Dec 28, 2022
Python ELT Studio, an application for building ELT (and ETL) data flows.

The Python Extract, Load, Transform Studio is an application for performing ELT (and ETL) tasks. Under the hood the application consists of a two parts.

Schlerp 55 Nov 18, 2022
small package with utility functions for analyzing (fly) calcium imaging data

fly2p Tools for analyzing two-photon (2p) imaging data collected with Vidrio Scanimage software and micromanger. Loading scanimage data relies on scan

Hannah Haberkern 3 Dec 14, 2022
Udacity - Data Analyst Nanodegree - Project 4 - Wrangle and Analyze Data

WeRateDogs Twitter Data from 2015 to 2017 Udacity - Data Analyst Nanodegree - Project 4 - Wrangle and Analyze Data Table of Contents Introduction Proj

Keenan Cooper 1 Jan 12, 2022
collect training and calibration data for gaze tracking

Collect Training and Calibration Data for Gaze Tracking This tool allows collecting gaze data necessary for personal calibration or training of eye-tr

Pascal 5 Dec 17, 2022
Clean and reusable data-sciency notebooks.

KPACUBO KPACUBO is a set Jupyter notebooks focused on the best practices in both software development and data science, namely, code reuse, explicit d

Matvey Morozov 1 Jan 28, 2022
Unsub is a collection analysis tool that assists libraries in analyzing their journal subscriptions.

About Unsub is a collection analysis tool that assists libraries in analyzing their journal subscriptions. The tool provides rich data and a summary g

9 Nov 16, 2022
A Python and R autograding solution

Otter-Grader Otter Grader is a light-weight, modular open-source autograder developed by the Data Science Education Program at UC Berkeley. It is desi

Infrastructure Team 93 Jan 03, 2023